mensonges_satanes_mensonges_statistiques_et_calculs_de_probabilite_de_l_abiogenese

Titre original : Lies, Damned Lies, Statistics, and Probability of Abiogenesis Calculations
Texte de Ian Musgrave.
Date : Copyright © 1998 - [Last Update: December 21, 1998]

La page originale disponible à l’adresse http://www.talkorigins.org/faqs/abioprob/abioprob.html

De temps en temps, quelqu'un arrive en affirmant “la formation d'une enzyme par hasard est presque impossible, donc l'abiogenèse est impossible”. Souvent, ils citent un calcul impressionnant de l'astrophysicien Fred Hoyle, ou mentionnent quelque chose appelé “la loi de Borel” pour prouver que la vie est statistiquement impossible. Ces personnes, dont Fred, ont commis une ou plusieurs des erreurs suivantes.

Glossaire

  • Acyl transférase: Une enzyme ou ribozyme qui synthétise des peptides.
  • Ligase: Enzyme ou ribozyme qui ajoute un monomère à un polymère ou relie deux polymères plus courts ensemble.
  • Monomère: Toute sous-unité unique d'un polymère. Un acide aminé est un monomère d'un peptide ou d'une protéine, un nucléotide est un monomère d'un oligonucléotide ou d'un polynucléotide.
  • Nucléotide: Adénine, Guanine, Cytosine et Uracile. Ce sont les monomères qui composent les oligo ou polynucléotides tels que l'ARN.
  • Oligonucléotide: Un court polymère de sous-unités nucléotidiques.
  • Polymérase: Enzyme ou ribozyme qui fabrique un polymère à partir de monomères. Par exemple, l'ARN polymérase fabrique de l'ARN à partir de nucléotides uniques.
  • Ribozyme: Un catalyseur biologique fabriqué à partir d'ARN.
  • Auto-réplicateur: Une molécule qui peut faire une copie identique ou quasi-identique d'elle-même à partir de sous-unités plus petites. Au moins quatre auto-réplicateurs sont connus.

Problèmes avec les calculs “c'est tellement improbable” des créationnistes :

1) Ils calculent la probabilité de formation d'une protéine “moderne”, voire d'une bactérie complète avec toutes les protéines “modernes”, par des événements aléatoires. Ce n'est pas du tout la théorie de l'abiogenèse.

2) Ils supposent qu'il existe un nombre fixe de protéines, avec des séquences fixes pour chaque protéine, qui sont nécessaires à la vie.

3) Ils calculent la probabilité d'essais séquentiels plutôt que d'essais simultanés.

4) Ils comprennent mal ce que l'on entend par un calcul de probabilité.

5) Ils sous-estiment sérieusement le nombre d'enzymes / ribozymes fonctionnels présents dans un groupe de séquences aléatoires.

Je vais essayer de guider les gens à travers ces diverses erreurs et montrer pourquoi il n'est pas possible de faire un calcul de «probabilité d'abiogenèse» de manière significative.

Ainsi, le calcul part de la probabilité de former une protéine longue de 300 acides aminés donnée (disons une enzyme comme la carboxypeptidase) au hasard est de (1/20) 300 ou 1 chance sur 2,04 x 10390, ce qui est étonnamment improbable. Ce chiffre est encore augmenté en ajoutant les probabilités de générer environ 400 enzymes similaires, jusqu'à obtenir un chiffre si énorme que le simple fait de le considérer vous fasse exploser le cerveau . Cela donne l'impression que la formation même du plus petit organisme semble totalement impossible. Cependant, c'est complètement incorrect.

Premièrement, la formation de polymères biologiques à partir de monomères est fonction des lois de la chimie et de la biochimie, et celles-ci ne sont de toute évidence pas aléatoires.

Deuxièmement, la prémisse dans son ensemble est incorrect pour commencer, parce que dans les théories modernes de l'abiogenèse, les premiers «êtres vivants» seraient beaucoup plus simples, pas même des protobactéries ou des pré-protobactéries (ce qu'Oparin appelait un protobiont [8] et Woese appelle un progénote [4]), mais une ou plusieurs molécules simples ne dépassent probablement pas 30 à 40 sous-unités. Ces molécules simples ont ensuite évolué lentement vers des systèmes d'autoréplication plus coopératifs, puis finalement vers des organismes simples [2, 5, 10, 15, 28]. Une illustration comparant un protobionte hypothétique et une bactérie moderne est donnée ci-dessous.

Les premiers “êtres vivants” auraient pu être une seule molécule auto-réplicante, similaire au peptide “auto-répliquant” du groupe Ghadiri [7, 17], ou l'hexanucléotide auto-répliquant [10], ou peut-être une ARN polymérase qui agit sur elle-même [12].

Un autre point de vue est que les premiers auto-réplicateurs étaient des groupes de catalyseurs, soit des enzymes protéiques soit des ribozymes à ARN, qui se régénéraient dans un cycle catalytique [3, 5, 15, 26, 28]. Un exemple est l'auto-réplicateur à trois sous-unités SunY [24]. Ces cycles catalytiques pourraient être limités dans un petit étang ou une lagune, ou être un complexe catalytique adsorbé sur de l'argile ou des matières lipidiques sur l'argile. Étant donné qu'il existe de nombreuses séquences catalytiques dans un groupe de peptides ou polynucléotides aléatoires (voir ci-dessous), il n'est pas improbable qu'un petit complexe catalytique puisse se former.

Ces deux modèles ne s'excluent pas mutuellement. Le peptide Ghadiri peut muter et former des cycles catalytiques [9].

Que les premiers auto-réplicateurs soient des molécules uniques ou des complexes de petites molécules, ce modèle n'a rien à voir avec la “tornade de Hoyle dans une décharge construisant un 747”. Juste pour marteler cette différence, voici une comparaison simple de la théorie critiquée par les créationnistes et de la théorie réelle de l'abiogenèse.

Notez que la vraie théorie a un certain nombre de petites étapes, et en fait, j'ai laissé de côté certaines étapes (en particulier entre l'étape hypercycle-protobiont) pour plus de simplicité. Chaque étape est associée à une petite augmentation de l'organisation et de la complexité, et les éléments chimiques se transforment lentement en organisme, plutôt que de faire un grand bond [4, 10, 15, 28].

D'où provient l'idée créationniste selon laquelle les organismes modernes se forment spontanément n'est pas certaine. La première formulation moderne de l'abiogenèse, l'hypothèse Oparin / Haldane des années 20, commence avec de simples protéines / protéinoïdes se développant lentement dans les cellules. Même les idées qui circulaient dans les années 1850 n'étaient pas des théories «spontanées». La plus proche qui peut s’en rapprocher est celle des idées originales de Lamarck de 1803! [8]

Étant donné que les créationnistes critiquent une théorie dépassée depuis plus de 150 ans et défendue par aucun biologiste évolutionniste moderne, pourquoi aller plus loin? Parce qu'il y a des problèmes fondamentaux en statistique et en biochimie qui apparaissent dans ces “réfutations” erronées.

Une autre affirmation souvent entendue est qu'il existe une “séquence vitale” de 400 protéines et que les séquences d'acides aminés de ces protéines ne peuvent pas être modifiées pour que les organismes soient vivants.

Mais cela n'a pas de sens. L'allégation de 400 protéines semble provenir du génome codant pour les protéines de Mycobacterium genetalium, qui possède le plus petit génome actuellement connu de tout organisme moderne [20]. Cependant, l'inspection du génome suggère que cela pourrait être encore réduit à un ensemble de gènes minimal de 256 protéines [20]. Notez à nouveau qu'il s'agit d'un organisme moderne. Le premier protobionte/progénote aurait été encore plus petit [4] et précédé de systèmes chimiques encore plus simples [3, 10, 11, 15].

Quant à l'affirmation selon laquelle les séquences de protéines ne peuvent pas être modifiées, c'est encore un non sens. Il existe dans la plupart des protéines des régions où presque tous les acides aminés peuvent être substitués, et d'autres régions où des substitutions conservatrices (où les acides aminés chargés peuvent être échangés avec d'autres acides aminés chargés, les neutres par d'autres acides aminés neutres et les acides aminés hydrophobes par d'autres acides aminés hydrophobes ) peut être fait. Certaines molécules fonctionnellement équivalentes peuvent avoir entre 30 et 50% de leurs acides aminés différents. En fait, il est possible de substituer des protéines bactériennes structurellement non identiques aux protéines de levure et des protéines de ver aux protéines humaines, et les organismes vivent toujours de façon joyeuse. La “séquence vitale” est un mythe.

Jouons donc au jeu créationniste et examinons la possibilité de former un peptide par addition aléatoire d'acides aminés. Ce n'est certainement pas ainsi que les peptides se sont formés sur la Terre primitive, mais ce sera instructif.

J'utiliserai comme exemple le peptide “auto-répliquant” du groupe Ghadiri mentionné ci-dessus [7]. Je pourrais utiliser d'autres exemples, tels que l'auto-réplicateur hexanucléotidique [10], l'auto-réplicateur SunY [24] ou l'ARN polymérase décrite par le groupe Eckland [12], mais pour la continuité historique avec les affirmations créationnistes, un petit peptide est idéal. Ce peptide est long de 32 acides aminés avec une séquence de RMKQLEEKVYELLSKVACLEYEVARLKKVGE et est une enzyme, une peptide ligase qui se copie elle-même à partir de deux sous-unités longues de 16 acides aminés. Il est également d'une taille et d'une composition qui sont idéalement adaptées pour être formées par synthèse de peptides abiotiques. Le fait qu'il s'agisse d'un auto-reproducteur est une ironie supplémentaire.

La probabilité de générer cela dans des essais aléatoires successifs est de (1/20) 32 ou 1 chance sur 4,29 x 1040. Ceci est beaucoup, beaucoup plus probable que le 1 sur 2,04 x 10390 du scénario créationniste standard “générant de la carboxypeptidase par hasard”, mais semble encore ridiculement faible.

Cependant, il y a une autre face à ces estimations de probabilité, et cela vient du fait que la plupart d'entre nous n'ont pas le goût des statistiques. Quand quelqu'un nous dit qu'un événement a une chance sur un million de se produire, beaucoup d'entre nous comprennent qu’un million de tentatives doivent être faites avant que cet événement ne se produise, mais c'est faux.

Voici une expérience que vous pouvez faire vous-même: prendre une pièce, la lancer quatre fois, noter les résultats, puis recommencer. Combien de fois pensez-vous avoir dû répéter cette procédure (essai) avant d'obtenir 4 faces d'affilée?

Maintenant, la probabilité de 4 faces d'affilée est de (1/2)4 ou 1 chance sur 16: devons-nous faire 16 essais pour obtenir 4 faces (FFFF)? Non, dans des expériences successives, j'ai eu 11, 10, 6, 16, 1, 5 et 3 essais avant que FFFF n'apparaisse. Le chiffre 1 sur 16 (ou 1 sur un million ou 1 sur 1040) donne la probabilité d'un événement dans un essai donné, mais ne dit pas quand il se produira dans une série. Vous pouvez obtenir FFFF lors de votre tout premier essai (je l'ai fait). Même à 1 chance en 4,29 x 1040, un auto-réplicateur aurait pu apparaître étonnamment tôt. Mais il y a plus.

1 chance en 4,29 x 1040 est toujours faramineusement, étonnamment improbable; il est même difficile de concevoir un tel nombre. Même avec l'argument ci-dessus (vous pourriez l'obtenir lors de votre tout premier essai), la plupart des gens diraient “il faudrait sûrement plus de temps que la Terre pour fabriquer ce réplicateur par des méthodes aléatoires”. Pas vraiment; dans les exemples ci-dessus, nous examinions des essais séquentiels, comme s'il n'y avait qu'un seul assemblage protéine / ADN / proto-réplicateur par essai. En fait, il y aurait des milliards d'essais simultanés/ alors que les milliards de molécules de blocs de construction interagiraient dans les océans, ou sur les milliers de kilomètres de rivages qui pourraient fournir des surfaces ou des matrices catalytiques [2,15].

Revenons à notre exemple avec les pièces. Disons qu'il faut une minute pour lancer les pièces 4 fois; pour générer FFFFF prendrait en moyenne 8 minutes. Prenez maintenant 16 amis, chacun avec une pièce, qui vont tous lancer la pièce simultanément 4 fois; le temps moyen pour générer FFFF est maintenant de 1 minute. Essayez maintenant de retourner 6 faces d'affilée; cela a une probabilité de (1/2)6 ou 1 sur 64. Cela prendrait une demi-heure en moyenne, mais sortez et recrutez 64 personnes, et vous pouvez l’obtenir en une minute. Si vous voulez obtenir une séquence avec une chance de 1 sur un milliard, il suffit de recruter la population de la Chine pour lancer des pièces pour vous, vous aurez cette séquence en un rien de temps.

Donc, si sur notre terre prébiotique, nous avons un milliard de peptides se développant simultanément, cela réduit considérablement le temps nécessaire pour générer notre réplicateur.

OK, vous regardez à nouveau ce nombre, 1 chance sur 4,29 x 1040, c'est un nombre énorme et bien qu'un milliard de molécules au départ, ça fait beaucoup de molécules, pourrions-nous jamais obtenir suffisamment de molécules pour assembler au hasard notre premier réplicateur en moins de la moitié d'un milliards d'années?

Oui, car un kilogramme d'acide aminé arginine contient 2,85 x 1024 molécules (c'est bien plus d'un milliard de milliards); une tonne d'arginine a 2,85 x 1027 molécules. Si vous preniez une charge de semi-remorque de chaque acide aminé et le déversiez dans un lac de taille moyenne, vous auriez suffisamment de molécules pour générer notre réplicateur particulier en quelques dizaines d'années, étant donné que vous pouvez fabriquer 55 longues protéines d'acide aminé en 1 à 2 semaines [14,16].

Alors, comment cela marche t’il sur la Terre prébiotique? Sur la Terre primitive, il est probable que l'océan avait un volume de 1 x 1024 litres. Étant donné une concentration en acides aminés de 1 x 10-6 M (une soupe modérément diluée, voir Chyba et Sagan 1992 [23]), il existe alors environ 1 x 1050 chaînes de départ potentielles, de sorte qu'un bon nombre de ligases peptidiques efficaces (environ 1 x 1031) pourrait être produit en moins d'un an, sans parler d'un million d'années. La synthèse des auto-réplicateurs primitifs pourrait se produire relativement rapidement, même avec une probabilité de 1 chance en 4,29 x 1040 (et rappelez-vous, notre réplicateur pourrait être synthétisé lors du tout premier essai).

Supposons qu'il faut une semaine pour générer une séquence [14,16]. Ensuite, la ligase de Ghadiri pourrait être générée en une semaine, et toute séquence du cytochrome C pourrait être générée en un peu plus d'un million d'années (avec environ la moitié de toutes les 101 séquences peptidiques possibles, dont une grande proportion seront des protéines fonctionnelles d’une façon ou d'une autre).

Bien que j'aie utilisé la ligase de Ghadiri comme exemple, comme je l'ai mentionné ci-dessus, les mêmes calculs peuvent être effectués pour l'auto-réplicateur SunY ou l'ARN polymérase Ekland. Je laisse cela comme un exercice pour le lecteur, mais la conclusion générale (vous pouvez faire des tas de choses en peu de temps) est la même pour ces oligonucléotides.

J'ai donc montré que générer une petite enzyme donnée n'est pas aussi difficile que les créationnistes (et Fred Hoyle) le suggèrent. Un autre malentendu est que la plupart des gens pensent que le nombre d'enzymes / ribozymes, sans parler des ARN polymérases ribozymales ou de toute forme d'autoréplication, représente une configuration très improbable et que le risque de formation d'une seule enzyme / ribozyme, sans parler d'un certain nombre d'entre eux, de l'addition aléatoire d'acides aminés / nucléotides est très faible.

Cependant, une analyse d'Ekland suggère que dans l'espace de séquence de 220 séquences d'ARN longues de nucléotides, une stupéfiante séquence de 2,5 x 10112 sont des ligases efficaces [12]. Pas mal pour un composé que l'on pensait auparavant uniquement structurel. Pour en revenir à notre océan primitif de 1 x 1024 litres et en supposant une concentration en nucléotides de 1 x 10-7 M [23], il existe alors environ 1 x 1049 chaînes de nucléotides potentielles, de sorte qu'un bon nombre de ligases d'ARN efficaces (environ 1 x 1034) pourrait être produit en un an, sans parler d'un million d'années. Le nombre potentiel d'ARN polymérases est également élevé; environ 1 séquence sur 1020 est une ARN polymérase [12]. Des considérations similaires s'appliquent aux acyl-transférases ribosomales (environ 1 séquence sur 1015) et à la synthèse des nucléotides ribozymaux [1, 6, 13].

De même, sur les 1 x 10130 protéines de 100 unités possibles, 3,8 x 1061 représentent le cytochrome C seul! [29] Il y a beaucoup d’enzymes fonctionnels dans l'espace de recherche peptide / nucléotide, il semblerait donc probable qu'un ensemble fonctionnel d'enzymes puisse être présent dans une soupe prébiotique de la Terre primordiale.

Ainsi, même avec des chiffres plus réalistes (quoique quelque peu stupéfiants), l'assemblage aléatoire d'acides aminés dans des systèmes “de vie” (que vous optiez pour des hypercycles à base d'enzymes protéiques [10], des systèmes de monde à ARN [18] ou la coévolution des ribozomes d'ARN- enzymes protéiques [11, 25]) semble tout à fait réalisable, même avec des chiffres pessimistes pour les concentrations de monomère d'origine [23] et les temps de synthèse.

La prémisse même des calculs de probabilité des créationnistes est incorrecte en premier lieu car elle vise la mauvaise théorie. En outre, cet argument est souvent étayé par des erreurs statistiques et biologiques.

Pour le moment, étant donné que nous n'avons aucune idée de la probabilité de la vie, il est pratiquement impossible d'attribuer des statistiques significatives à l'une des étapes de la vie, à l'exception des deux premières (monomères aux polymères p = 1, formation de polymères catalytiques p = 1). Pour la réplication des polymères vers la transition hypercycle, la probabilité pourrait bien être de 1 si Kauffman a raison sur la fermeture catalytique et ses modèles de transition de phase, mais cela nécessite une chimie réelle et une modélisation plus détaillée pour être confirmer. Pour la transition hypercycle→ protobionte, la probabilité dépend ici des concepts théoriques encore en cours d'élaboration et est inconnue.

Cependant, la faisabilité de la fin de vie dépend de la chimie et de la biochimie que nous étudions toujours, et non du lancer de pièces.

Merci à John Wilkins et Jthomford pour leurs suggestions et discussions utiles. Merci à John pour ses astucieux GIF et JPEG.

  • Dernière modification: 2019/12/13 18:04
  • (modification externe)